SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005429 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005429
Domain Number 1 Region: 106-352
Classification Level Classification E-value
Superfamily L domain-like 1.02e-28
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 2 Region: 11-123
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.67e-26
Family Cap-Gly domain 0.0011
Further Details:      
 
Domain Number 3 Region: 422-510
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.57e-22
Family Ubiquitin-related 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005429   Gene: ENSAPLG00000005834   Transcript: ENSAPLT00000006059
Sequence length 510
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743543.1:261051:283121:1 gene:ENSAPLG00000005834 transcript:ENSAPLT00000006059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNVLHLKMYLPYFSGIWLGVEWDDPQRGKHDGTYEGTQYFKCRHPRGGSFIRPNKANFGV
DFLTAVKDRYGLKEQDVQNGTKNTLVLGKKTVELIGMDSIAEQQSQLNLLVDISVRECAV
SHAGQKEEISRTCANIRHINLSKNLLSSWDTVTDIASQVPNLETLNISENKMKFPSTSIS
VSNVFSKLKVLALNQTEITWTEVLVCAQGWPALEELYLTSNNITVLESRPDNVLQTLKLL
DLSDNPLLDGDQLHQIAYLPRLEQLILRNTGISSIYFPDSEFGCKTKMFPSLKRLAINDN
KISQWSSINELEKLPSLQSLQCHNNPLMDTEKNPETLRQLIIAKLSQLEVLNKSEILPAE
RKGAELDYRKIFGKEWLAAGGNWNPERNKPSEEFLAAHPRYTALCLKYGAPEEGELKGQQ
PSTLKNQLLTLTIKCPDKPEQKPVEKKLPESMTIQRVKGLLYRLLKIPGSELKLSYESSK
LAGKEVELDNDLKPLQFYSIENGDCVLVRW
Download sequence
Identical sequences U3IDV7
ENSAPLP00000005429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]