SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005499 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005499
Domain Number 1 Region: 621-923
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-84
Family Protein kinases, catalytic subunit 0.000000000328
Further Details:      
 
Domain Number 2 Region: 25-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-76
Family Ephrin receptor ligand binding domain 0.0000000964
Further Details:      
 
Domain Number 3 Region: 327-532
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-39
Family Fibronectin type III 0.00000293
Further Details:      
 
Domain Number 4 Region: 915-986
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.03e-21
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 5 Region: 257-330,365-384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000183
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005499   Gene: ENSAPLG00000005830   Transcript: ENSAPLT00000006130
Sequence length 991
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743085.1:614114:639569:1 gene:ENSAPLG00000005830 transcript:ENSAPLT00000006130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAVHHPGAEILAAPCLFEGLCVFPETLMDTRTATAELGWTANPPSGWEEVSGYDENLNTI
RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYY
ETDSVIATKKSAFWTEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYL
AFQDYGACMSLLSVRVFFKKCPSVVQNFAIFPETMTGAESTSLVTARGTCIPNAEEVDVP
IKLYCNGDGEWMVPIGRCTCKAGYEPENNVACKACPAGTFKASQGAGLCAPCPPNSRSTA
AASPLCACRNGYYRADLDPPAAACTSVPSGPRNVISIVNETSIILEWNPPRETGGRDDVT
YNIVCKKCRSDRRACSRCDDNVEFVPRQLGLTETRVFISSLWAHTPYTFEIQAVNGVSNK
SPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYELRYYEKD
HNEYNSSMARSQTNTARIEGLRPGMVYVVQVRARTVAGYGKYSGKMCFQTLTDDDYKSEL
REQLPLIAGSAAAGVVFIVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGQGSPGMKI
YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTL
KAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQND
GQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDT
SDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDV
INAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNTRPRFTEIVNTLDKMIRNPASLKTVAT
ITAVPSQPLLDRSIPDFTAFTSVEDWLSAVKMSQYRDNFLSAGFTSLQLVAQMTSEDLLR
IGVTLAGHQKKILNSVQSMRVQMSQSPTSMA
Download sequence
Identical sequences U3IE27
ENSAPLP00000005499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]