SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005500 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005500
Domain Number 1 Region: 157-241
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-16
Family Linker histone H1/H5 0.006
Further Details:      
 
Domain Number 2 Region: 344-412
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000018
Family Linker histone H1/H5 0.012
Further Details:      
 
Domain Number 3 Region: 258-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000218
Family Linker histone H1/H5 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005500   Gene: ENSAPLG00000005878   Transcript: ENSAPLT00000006131
Sequence length 559
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744266.1:250837:264216:1 gene:ENSAPLG00000005878 transcript:ENSAPLT00000006131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDLSEAEPVHHKALPLLTGAQLIHTDKLSEKVEDETMPIRRSVNSSSRETPPKSKPAE
GGEEVKADAEATSEESASAGEEQENETLPAASSEAEQPKEPENEGKGETKSSEETKKDEK
DQSKEKEKKVKKTIPAWATLSASQLARAQKQTQMAATSRPKMDAILTEAIKACFQKSGAS
VVAIRKYIIHKYPSLELERRGYLLKQALKRELERGIIRQVKGKGASGSFVVVSNAGKTVP
KARDRKKSTSASTPEQQVKLEDILPLAFTRLCEPKEASYSLIKKYVSQYYPKLKVDVRPQ
LLKNALQRAVEKGQLEQITGKGASGTFQLKKSGEKPLLGGTLMEDAILSAIAAMNEPKTC
STTALKKYILENHPGTNSNFQVHLLKRTLQRCEKNGWLEQISGKGFSGTFQLCFPYYPST
RMLITSRTQLFASRNADVEEGWEEDDGRWAVVPNENRGYPPPKKRMQKRPPPKSRSRAPP
MKRRESKPKPRKTPAARSGKAKPPPKVKTPAKKAKPAAPAIKKPSGGSSSKKPAASGRKE
VKPSAKGKPTMRKSLRAKK
Download sequence
Identical sequences U3IE28
ENSAPLP00000005500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]