SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005541 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000005541
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0125
Family Hypothetical protein YhgG 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005541   Gene: ENSAPLG00000005969   Transcript: ENSAPLT00000006172
Sequence length 85
Comment pep:novel scaffold:BGI_duck_1.0:KB742789.1:60178:62304:1 gene:ENSAPLG00000005969 transcript:ENSAPLT00000006172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLKNLPLKGKVTSFQQHISGCCVDSCCDCKFPAVWGWGWRREKGSLQQPQLLQAEKGCG
LGREGGQSPTAGLWGSPVVTPGCCM
Download sequence
Identical sequences U3IE69
ENSAPLP00000005541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]