SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005600 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005600
Domain Number 1 Region: 1314-1439,1605-1762
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.57e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 333-440
Classification Level Classification E-value
Superfamily Sema domain 1.83e-18
Family Sema domain 0.015
Further Details:      
 
Domain Number 3 Region: 874-964
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000433
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 4-64
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000602
Family Sema domain 0.01
Further Details:      
 
Domain Number 5 Region: 784-863
Classification Level Classification E-value
Superfamily E set domains 0.00000000000165
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 6 Region: 443-495
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000157
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 7 Region: 963-1050
Classification Level Classification E-value
Superfamily E set domains 0.00000000216
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000005600
Domain Number - Region: 1110-1163
Classification Level Classification E-value
Superfamily E set domains 0.0467
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number - Region: 602-639
Classification Level Classification E-value
Superfamily Plexin repeat 0.0523
Family Plexin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005600   Gene: ENSAPLG00000005859   Transcript: ENSAPLT00000006231
Sequence length 1829
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742579.1:1040011:1119097:-1 gene:ENSAPLG00000005859 transcript:ENSAPLT00000006231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEETRGPVPNSACHAPQLPQASCEHPKVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQXR
RATSSASCAPSSPPAAAAPFPRPVPPRPGSPARGGAHTGGLVPLRSGEKFAAVTISYRVD
CFNTAFFPSSASCWKHSKENTSVRVFLSSGDLTPCSKWRRWQTVDSNLQLGRDQQNLLAF
WSRGAVLVPAFGQQLCQQLWGWLALRGPVSKRAWGNLEFVFLFLSHLCLKLGATSGQKPS
LVDSLIKLWLQHSGRLGLGDIEEESLHFFLCHCSFAPVNEWEREPWYQPGQFSPAALVRS
PVGAVVGLQGCASQPAPTILSVLWSHVQGTARTCSPGHRTSVSPQLQPEQLDCGAAHLQH
PLAIVXAVAVASVNNYTVVFLGTASGGLLKINLDSAMKVVSRRSISVAYGEPVHPIMQFD
PSDSTFLYLMTSYQMTRVKVAVCNQYSTCAECLAAADAYCGWCTMETRCSLQHECTNFTE
TNFWASASEGVQQCPSMTILEPEINIEKEKPALIIQINGTIPNLNGTNISCDYGNNIHTV
ARVAGDYANQFIYCSLLPREKYPAFPDNQDHVIVETALRVNSKNIIRANFTIYDCKRTGN
IYPKRACTSCLSTKWKCYWCPSTYMCVSNRSQCEDTLQMKKKIDCPRIVPVSLDPMPTGT
SRDITISLANATFSKETALECHFGTDRTFEARWVNSSAVECVHVLLHTSEKSHLFPVNLQ
LKDRPDRFIDSPETMTVEVYNCGTGSADCSQCLGREDLGHRCVWSESSSSCRLSTEFPQI
SDMCPAPEIKKIEPLRGPLEGGTLLTIRGRNLGRRFSDIRGAVRIGSVPCAPLPHRYSAG
ARIVCQTGEALEVFSDVVTVNVSREGKSKERYSYVLPVVQSIAPPNGPKAGGTRVTIRGS
RLDVGSELRVLVNGSRQCTDLSRNDSTITCTMPSAELTTAVRVCVQFENRSCASYNITFK
YEKNPIITDINPKKSQISLQSGGRIITLEGRGFELVQNVSMMVRGIGREQTSCKVHNDTV
ITCPSPAASNITAGSKPAPVDFYLNGRLYTDDRPALDEEMYPEEALHISKFSLEYYADPQ
FFTAKKEKWIKHHPGEPLTLVIHKEPDNLGLESNEYQVKIGLISCEIQIVSDKVIHCSVN
ESLSTSERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKS
RRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTR
TFFPKCSSLYEECYILPSQQLSSQVGSQVQETHPLLVGEWKIPENCRPNMEEGISLFSTL
LNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASAS
KNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGK
ARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVP
YSQWPRVEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSD
KKDATLSRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQK
FLDDLFKAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNIL
KNPQFVFDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQ
RYYKQIHDMPPLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANP
TTKRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences U3IEC8
ENSAPLP00000005600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]