SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005727 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005727
Domain Number 1 Region: 323-398
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000155
Family MarR-like transcriptional regulators 0.069
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000005727
Domain Number - Region: 230-289
Classification Level Classification E-value
Superfamily Translin 0.0183
Family Translin 0.02
Further Details:      
 
Domain Number - Region: 121-203
Classification Level Classification E-value
Superfamily TPR-like 0.0295
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005727   Gene: ENSAPLG00000006091   Transcript: ENSAPLT00000006359
Sequence length 447
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743421.1:60015:82040:-1 gene:ENSAPLG00000006091 transcript:ENSAPLT00000006359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYDLTTRIAHFLDRHHECISCILVFVNQLQIYNEKELLQGKLDLLSDTNMVDFAMDVY
KNLYSDEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLA
EKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEIL
MQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLY
QPQYLNAIQTMCPRLLRYLTTAVITNKDVRKRGQVLKDLVKVIQQESYTYRDPITEFVEC
LYVNFDFDGAQKKLRECETVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISIGMLAD
KLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQML
AMNIEKKLNQSGRSEAPNWATQDSGFY
Download sequence
Identical sequences U3IEQ5
ENSAPLP00000005727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]