SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005730 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005730
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.08e-28
Family La domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 103-197
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-17
Family Canonical RBD 0.0000178
Further Details:      
 
Domain Number 3 Region: 236-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000719
Family Canonical RBD 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005730   Gene: ENSAPLG00000006109   Transcript: ENSAPLT00000006362
Sequence length 423
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743045.1:1289566:1295236:-1 gene:ENSAPLG00000006109 transcript:ENSAPLT00000006362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGDGENMSILESKICQQIEYYFGNHNLPRDKFLKEQIKLDDGWVPLEVMIKFNRLSR
LSKDFGVIVEALRKSKTGLMEINEDKTKIRRSPNKPLPELNDQYKAAIKNRSVYVKGFPV
DATLDDIKEWLEDKGPVENIQMRRTLQKTFKGSIFAVFDSVESAKKFTEIPNQKYKDTEL
IVLFKEEYCTKKNEERKQNKVEAKARAKQEKEEKLKKAADAEMKSLEEKTGCLLKFFGDL
DDQTCREDLHTVFSDHGEIKWIHFVRGAKEGIILFKDTAKEALEKAKEAHNGNLQLRNKD
VTWELLEGDEEKEALKKIMEEQQELLKQKTKGPSFIEAFTMSHEWHFVKIRRKLKGKGRG
GKIPQGAQKGKVQFQGKKIKFEEEGEDDTKTEPASPKKRPLEEMEEEEPAPKQLKTENGA
GDQ
Download sequence
Identical sequences U3IEQ8
ENSAPLP00000005730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]