SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005810 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005810
Domain Number 1 Region: 48-249
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 18-55
Classification Level Classification E-value
Superfamily PH domain-like 0.00000516
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000005810
Domain Number - Region: 549-651
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000131
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005810   Gene: ENSAPLG00000006223   Transcript: ENSAPLT00000006443
Sequence length 666
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:4119486:4155197:-1 gene:ENSAPLG00000006223 transcript:ENSAPLT00000006443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKVQLSSLAGADRERMTANHETYLLMAGTQNDMEDWVKSIRRVIWAPFGGGIFGQKLEDT
VRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDS
NTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKMLSKEEETGLKELVKQVKSLPAVN
YNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSV
MISKHEELFPKDADPEMGPEVCNNNNEMPKKAIVGQLQNKENNNTKETAVRRCSWDKPES
PQRGSVDNESPTAQPGSKTNSPRNSIQKLDVTRSPPLMVKKNPAFNKGSGIVTNGSFSSS
VEGQEKSQTLPNCTLQSRRTSSLKGAVTKMGTQSMQNGGVRMGVSSTDGLPTTLNNRAAG
WAPNGYVTLRDNKQKDSVSESGQHNRLSTYDNVHQQFSMVNSDDKQSVDSATWSTSSCEI
SLPEHSTSCRSSTTTCPEQDFFAGNFEDSVLDGPPNEDLSNPGDYENKSDRRSVGGHSSR
ATSSSDNSETFVANSTNNHSALHSLVSSLKQEMAKQKLEYETRLKSLEQRNLTLETELMA
LHDELDQERKKFTMVEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRPERG
NTIWIQ
Download sequence
Identical sequences U3IEY8
ENSAPLP00000005810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]