SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005878 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005878
Domain Number 1 Region: 411-543
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-34
Family DEP domain 0.0000091
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-24
Family DIX domain 0.0025
Further Details:      
 
Domain Number 3 Region: 237-348
Classification Level Classification E-value
Superfamily PDZ domain-like 2.53e-23
Family PDZ domain 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005878   Gene: ENSAPLG00000006207   Transcript: ENSAPLT00000006513
Sequence length 708
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742382.1:490278:561793:-1 gene:ENSAPLG00000006207 transcript:ENSAPLT00000006513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKIIYHIDEEETPYLVKLPVPPEKVTLADFKNVLSNRPVHSYKFFFKSMDQDFGVVK
EEISDDNARLPCFNGRVVSWLVLAESSHSDTGSQCTESHADLPPPIERTGGIGDSRPPSF
HPNAASSRDGLDNETGTESVISHRRDRHRRRNREGHEDVPRINGHPKLDRHREHPPGYDS
SSTMMSSELESSSFIDSDDDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQIDRSSSF
SSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPVRP
IDPAAWISHTTAMTGAYPRYGMSPSMSITTSTSSSLTSSIPDSEKLEESPLTVKSDMATI
VKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKDRREARKYASSMLKHG
YLRHTVNKITFSEQCYYVFGDLCGNMAALNLNNGSSGASDQDTLAPLPHPAAPWPLGQGY
PYQYPLPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSNRSNSENSRRALGREKDRKS
AGSGSESDHTARSGGGASVVRRERPVSQLSHRSHVSATHSERSHHSHHSYGPPGVPPLYN
LPKSTGRAAPPEGPPVRELSSVPPELTGSRQSFQKAMSNPCEFFVDIM
Download sequence
Identical sequences U3IF56
ENSAPLP00000005878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]