SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005893 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005893
Domain Number 1 Region: 302-411
Classification Level Classification E-value
Superfamily ARID-like 3.92e-34
Family ARID domain 0.00031
Further Details:      
 
Domain Number 2 Region: 568-644
Classification Level Classification E-value
Superfamily Chromo domain-like 5.89e-16
Family Chromo barrel domain 0.012
Further Details:      
 
Domain Number 3 Region: 57-111
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000322
Family Tudor domain 0.013
Further Details:      
 
Domain Number 4 Region: 187-290
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000436
Family PWWP domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005893   Gene: ENSAPLG00000006185   Transcript: ENSAPLT00000006529
Sequence length 1274
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742996.1:11624:57630:1 gene:ENSAPLG00000006185 transcript:ENSAPLT00000006529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVVLKGDNSTQLVQDDQVKGPLRV
GAMVETKMPDGSFQEAVISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLDQ
LPLTNPEHFGTPVIGKKSNRGRRSSIPVTEDEKEEESSEEEDEDKRRLNDELLGKVVTVT
CNSEKSDWYPALVVSPSCNDDVTVKKDQCLVRSFADSKFYSVARKDIKELDALNLPKSES
SPKKGLQEASTFLNTKTVPRNWKMDISEIMESSSSDEEGATAETDEEEIKREEKNEEVTP
EEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYQQGGCDNIESGA
VWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTIHHNEPKVVEDIQK
HEEPMEESVKEEQKMPPTEVKKEAEENYSSSESEKEEIELRSPRGRRRLARDATPAKRES
EEDKTQDKLKDSNKENKDIEETLENAEKKENETPLGRKTTPKQKEKKIKKQEESDKESDE
EEERQREREEMENKGESEGEEDEEDTEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDG
EVLYLVHYYGWNVRYDEWVKADRIIWPVDKGGPKRKQKKRTKNKEDSEKDEKKEEEKQKS
KRGRPPLKSTLPSNTSLSKTPNSEGKSGARSARNNLSDSSPLPNGTEDSGSSDSEADESS
EKNLNEEFSPETSELEKNEKLNDEKLDEESPKIPHALRENDRSQVQPLETLKLEVEESEQ
IVQIFGNKSEQMEEIKREAEKSPKGKGRRSKTKDPCLENAKISPGSQEDVANESLTESER
LDMSSLDCKEISSTTESEMEPSTKDKKLLKRKTSEQASPEKRSRRESEMEVPNIVSDERT
NECTGAEECRGLNAEESLRTENEEMPSLVAESVQHGQEMRNENFECPSEENDNVPLKDED
DAMPQIGPETLLCHEVDLDDLDEKEKSSSEDTISEKPDPNTSNSNPSALPPAAQSSFSVA
SPLTLSQDESRSIKSESDMTIEVDSVAEESQEGLCESESANGFEASTTSSNCSIAVQERD
IGEKGQKRPSDSSSGTLAKKQKRTPKRSSAAAKNEKNGTGQSSDSEDLPVLDSSSKCTPV
KHMNSSKPQKISRSPARVMSPHIKDGEKDKHREKHHHQNASPRVHKWSFQLNELDNMSSA
ERISFLQEKLQEIRKYYMSLKSEVATIDRRRKRLKKKDREVSHTGASMSSASSDTGMSPS
SSSPPQNVLAVECR
Download sequence
Identical sequences U3IF71
ENSAPLP00000005893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]