SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005897 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005897
Domain Number 1 Region: 507-775
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.5e-111
Family N-acetyl transferase, NAT 0.0000000000858
Further Details:      
 
Domain Number 2 Region: 252-323
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.51e-17
Family PHD domain 0.0056
Further Details:      
 
Domain Number 3 Region: 92-175
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000245
Family Linker histone H1/H5 0.018
Further Details:      
 
Domain Number 4 Region: 203-266
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000035
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005897   Gene: ENSAPLG00000006273   Transcript: ENSAPLT00000006533
Sequence length 1945
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744812.1:343429:379328:-1 gene:ENSAPLG00000006273 transcript:ENSAPLT00000006533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLGESSGSSLKN
IERFLKGQKDVSALFGGSAASVFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKATTNAEGK
ESFESLSCLPPVCLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKNQNATSKGPFSKVRTG
PGRGRKRKITLSSQSASSEGGYLEQTDVLDFCRDGSTTLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSQQYRIRKKGTRKSSTSEWPTDNQDGWDGKQENEERFFGSQDVLTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIQTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQHDKQLSIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQEHMAKLRTNVRPIDVDAECLRWTPVIV
SNSVVSEDEEEETEDGENEEQQHQKEKDSEASMVKSVSWEKKEQEPYSPTKNEKKPDIVA
PVSSTRPNKHVFPLDSLPANSQSSRRGRWNRKGKKLRETFCEKEPILPTEDKTDIPGERC
SECEEKSAASQGRCSECEEKSTALQVQYGKSEKSAIPRRRYSEGMERWRGQLKNMESLKC
RFPEDCERLPRRYRDSDRALPRCFSESSEDDDDDPVSPRSSSPPVLTKPTLKRKKPILHR
KRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFENELLPSGYFRHLA
PQDTLRNRPSSKRKSKDEEESDDTNGTPTLKPLSMLRKCEAKDCSLEPDTSTPMKKKKGW
PKGKSRKPIHWKKRPGRKPGFKLNREKVPSSVQGEGADAVVGNSKPGRKPKISDEEEGVE
QKEELPLNTASSEVRAVSPVDSSSSPVPEVKEPEIEEEVEEKPRVLEEQRQSEEEQQELD
EPEHDHEEEDEIAVVTNQNEDHDADDEDDGHLESMKKKELEEQPAREGVKEEPDVQECFL
EADMQNSREDAKGKDEAEADSEEEQASNETSVGSEHVPGSEDDHEEEQSNKEGLIELKEE
EEIPHSELDLETVQAVQSLTQEESNEHDVAYQDCEETLAACQTLQSYTQTEEDPQISMVE
DCQASEHNSPISSVQSHPSQSVRSVSSPNVPALESSYTQISPEQGSLSAPSMQNMETSPM
MDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSYGGL
SSSSSLTQNSCVVTQQMANIGSSCSMMQQSTVQPAANCNIKSPQSCVVERPPSNQQPAPQ
PQQQQPQSQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDF
GAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHP
LAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRS
KSAPLPSASAHQQQLYGRSPPAVAMQAGPRTLAVQRGMNMGVNLMPTTPYNVNSMNMNTL
NAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYT
GPSHHSYMNAAGVPKQSLNGPYMRR
Download sequence
Identical sequences U3IF75
ENSAPLP00000005897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]