SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005899 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005899
Domain Number 1 Region: 2-119,386-513
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.09e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0002
Further Details:      
 
Domain Number 2 Region: 187-359
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.86e-45
Family Group II chaperonin (CCT, TRIC), apical domain 0.00031
Further Details:      
 
Domain Number 3 Region: 124-193,352-386
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.5e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005899   Gene: ENSAPLG00000006259   Transcript: ENSAPLT00000006535
Sequence length 535
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742815.1:787013:793254:-1 gene:ENSAPLG00000006259 transcript:ENSAPLT00000006535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVTAASAIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAD
LQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSIIGGYRLACKEAVRYINENLTINT
DELGRECLINAAKTSMSSKIIGIDGDFFANMVVDAAMAVKYTDQKGQARYPINSVNVLKA
HGRSQKESILVNGYALNCVVGSQGMTKRIVNAKIACLDFSLQKAKMKLGVQVVISDPEKL
DQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVVKKDLKRIA
KASGATVCSTLANLEGEESFEALMLGQAEEVIQERICDDELILIKNTKARTSASIILRGA
NDFMCDEMERSIHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAE
FARSLLIIPNTLAVNAAQDATDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQ
AGVFEPTMVKTKSLKFATEAAITILRIDDLIKLHPETKEDRGCYEDAVHSGALEE
Download sequence
Identical sequences U3IF77
ENSAPLP00000005899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]