SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005982 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005982
Domain Number 1 Region: 166-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-47
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 1773-1839
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.57e-19
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 617-715
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-19
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 4 Region: 512-586
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-19
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005982   Gene: ENSAPLG00000006385   Transcript: ENSAPLT00000006618
Sequence length 1841
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743402.1:1238683:1553998:-1 gene:ENSAPLG00000006385 transcript:ENSAPLT00000006618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPTSSEDEMAQSFSDYSVESESDSSKEETIYDTIRATAEKPSSRMDDSQSNTLVIRI
IIPDLQQTKCIRFNPEASVWVAKQRILCTLNQSLKDVLNYGLFQPASNGRDGKFLDEERL
LREYPQPVNKGVPSLEFRYKKRVYKQFNLDEKQLAKLHTKANLRKFMDHVHHLSVEKITK
MLDRGLDPNYHDLESGETPLTLAVQLDNTVEVIKALKNGGAHLDFRAKDGMTALHKAARA
KNQVTLKTLLELGASPNYKDSCGLTPLYHTAVVGGDPYCCELLLHEHATVSCKDENGWQE
IHQACRYGHVQHLEHLLFYGADMCAQNASGNTALHICALYNQESCARVLLFRGANKEIKN
YNSQSPFQVAIIAGNFELAEYIKNHREADIVPFREAPTYSNRRRRPPSTLAAPRILLRSN
SDNNLNINNLPEWSASSSASSHRSLSPHLLQQMQNNPNGTVKTVGSYTPSSRSRSPSLNR
LGEDAKRQQHRHISAVYGPSANKDPLSALDYQGPKRKLYSAVPGRLFIVVKPYQPQGEGE
IHLHKGDRVKVLSIGEGGFWEGSTRGHVGWFPAECVEEVQCKPNESKPETRSDRTKKLFR
HYTVGSYDSFDASSDCIIEEKAVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQY
LESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLD
PDDTARKKGKAPPPPKRAPTTALTLRSKSMTSELEELDKVDEIVPVSKPSRIADNATVDS
RVATIKQRPSSRCFPSATDMNSMYERQGIAVMTPTVPGSPQGPFLGIPRGTMRRQKSIVI
YTFCFLGITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSLPPSPPPPSPSLYNSPKS
PTSRSYGTIKPPFNQNSGAKISLVRPENVGTMIRDKGIYYRRELDRYSLDSEDLYSRSAT
SQANFRNKRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVEDSPEKTCSIPIP
TIIVKEPSTSSSGKSSQGSSMEIDPQSSEQPGQLRPDDSLGVSSPFAAAIAGAVRDREKR
LEARRNSPAFLSTDLGDEDVGLTPPTPRMRQSKFTDEAMFSSEDGFRQLMSPSPIPAPRE
PENIFNSSEPSNQSDSRTLNASSKTKGTENSTVAAKPTNASSSDNYVHPVTGKLLDPNSP
LALALSARDRAMKEQTQQIPGKGDTVKPDLNKPLYIDTKLRPNIETTFPVTATVTRQNTR
GPLRRQETENKYETDAGKEKKAEEKKNMLINIVDTSQQKSAGLLMVHTMDTAKSDDAPED
EEEKRDEMEPNPENSPPERPEGSEEAESELDVPAAPEPPASPCKTIVAASSVDDPVILPF
RIPPPPLASVDIDEEFIFTEPLPPPLEFANSFDIPDDRSAPGSALTDLIKQRKNGTPSPA
PFAPSQSTNSLDSKKQVGLSNCLPASFLPPPDSFDNVTDSGIEEVDSRSSSDHHLETTST
ISTVSSISTLSSEGGENVDTCTVYADGQTFLVDKPPVPPKPKMKPIINKSNALYKDALIE
ETVDSFVIPPPAPPPPPISAQPNMAKVVPQRTSKLWGDVTEVKSPILSGPKANVISELNS
ILQQMNREKSSKPGEGLESPTGTKTASLSTRSTEVMSTVSGTRSTTITFTVRPGTSQPIT
LQSRSPDYDSRTSGARHAPSPVVSPTEINKDIMPAPLTASASASSPSPTLSDVFSLPSQP
PSGDLFGLTTGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFM
DNEIDGTHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
Download sequence
Identical sequences U3IFG0
ENSAPLP00000005982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]