SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006102 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006102
Domain Number 1 Region: 11-104
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.26e-26
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 415-478
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.08e-18
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 350-414
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.44e-17
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 170-253
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-16
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006102   Gene: ENSAPLG00000006487   Transcript: ENSAPLT00000006742
Sequence length 505
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744586.1:43468:55245:1 gene:ENSAPLG00000006487 transcript:ENSAPLT00000006742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPELLGSAKRVNVNFQDTDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHY
AAWQGKKEPMKMVLKAGSSVXXXSDEGQIPLHLAAQHGHYDVVQRGRGGAGVALGRRGGR
WXPSDGTELGGAASSRALSVPLQSGINAHVRNTYNQTALDIVNQFRAGHPVTLPSVPADA
SAALQVRAVKDYCNNYDLTSLNVKAGDVITVLEQHADGRWKGCIHDNRTGNDRVGYFPSS
LVEAISKRTVSGSWETVTIPQHDRILETATCPPCHPVLAARGGWEPRTCAGGDRSSLGST
GSGQSAGSGAHALHASSEGVKQCPHDASPAGHQHCGVVTVLGSRAWVLPLSLQSSEAVYQ
WLCKFQLQLYAPNFINAGYDITTISRMTPEDLTAIGVTKPGHRKKIASEINNLNIPEWLP
ANLALWLSMIGLSQYYKLLVENGYENIDFITDITWEDLQEIGITKLGHQKKLMLAXQRAE
LGKYEPGTLKRKAAAGPEVLAIESP
Download sequence
Identical sequences U3IFT0
ENSAPLP00000006102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]