SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006114 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006114
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-26
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 437-499
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.12e-18
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 373-435
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.59e-17
Family SAM (sterile alpha motif) domain 0.0033
Further Details:      
 
Domain Number 4 Region: 182-256
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-16
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006114   Gene: ENSAPLG00000006487   Transcript: ENSAPLT00000006754
Sequence length 526
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744586.1:43477:55245:1 gene:ENSAPLG00000006487 transcript:ENSAPLT00000006754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLGSAKRVNVNFQDTDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAAW
QGKKEPMKMVLKAGSSVXXXSDEGQIPLHLAAQHGHYDVVQRGRGGAGVALGRRGGRWXP
SDGTELGGAASSRALSVPLQSGINAHVRNTYNQTALDIVNQFXPSRWGWDLGGALADASA
ALQVRAVKDYCNNYDLTSLNVKAGDVITVLEQHADGRWKGCIHDNRTGNDRVGYFPSSLV
EAISKRTETQPLRRPPLPAQPPVDRPPAPTEEIWVLRKPFAGGDRSSLGSTSGSGQSAGS
GAHALHASSEGVKMLSPVLLAPSVAAAAPAGSARMMPXGGAGSSRSQSVASSPYAPQPAA
EQQLKKMEPPSEGKSSEAVYQWLCKFQLQLYAPNFINAGYDITTISRMTPEDLTAIGVTK
PGHRKKIASEINNLNIPEWLPANLALWLSMIGLSQYYKLLVENGYENIDFITDITWEDLQ
EIGITKLGHQKKLMLAXQRAELGKYEPGTLKRKAAAGPEVLAIESP
Download sequence
Identical sequences U3IFU2
ENSAPLP00000006114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]