SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006121 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006121
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.43e-26
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 435-497
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.12e-18
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 371-433
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.59e-17
Family SAM (sterile alpha motif) domain 0.0033
Further Details:      
 
Domain Number 4 Region: 167-258
Classification Level Classification E-value
Superfamily SH3-domain 1.13e-16
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006121   Gene: ENSAPLG00000006487   Transcript: ENSAPLT00000006761
Sequence length 524
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744586.1:43477:55245:1 gene:ENSAPLG00000006487 transcript:ENSAPLT00000006761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLGSAKRVNVNFQDTDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAAW
QGKKEPMKMVLKAGSSVXXXSDEGQIPLHLAAQHGHYDVVQRGRGGAGVALGRRGGRWXP
SDGTELGGAASSRALSVPLQSGINAHVRNTYNQTALDIVNQFTGAGHPVTLPSVPADASA
ALQVRAVKDYCNNYDLTSLNVKAGDVITVLEQHADGRWKGCIHDNRTGNDRVGYFPSSLV
EAISKRTADPAPPPPSPPGAAAVDRPPAPTEEIWVLRKPFAGGDRSSLGSTSGSGQSAGS
GAHALHASSEGVKMLSPVLLAPSVAAAAPAGSARMMPGGGSSRSQSVASSPYAPQPAAEQ
QLKKMEPPSEGKSSEAVYQWLCKFQLQLYAPNFINAGYDITTISRMTPEDLTAIGVTKPG
HRKKIASEINNLNIPEWLPANLALWLSMIGLSQYYKLLVENGYENIDFITDITWEDLQEI
GITKLGHQKKLMLAXQRAELGKYEPGTLKRKAAAGPEVLAIESP
Download sequence
Identical sequences U3IFU9
ENSAPLP00000006121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]