SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006134 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006134
Domain Number 1 Region: 8-97
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-24
Family Ankyrin repeat 0.00071
Further Details:      
 
Domain Number 2 Region: 449-512
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.05e-18
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 384-448
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.54e-17
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 160-242
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006134   Gene: ENSAPLG00000006487   Transcript: ENSAPLT00000006775
Sequence length 537
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744586.1:43477:55239:1 gene:ENSAPLG00000006487 transcript:ENSAPLT00000006775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLGSAKRVNVNFQDTDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAAW
QGKKEPMKMVLKAGSSVDEGQIPLHLAAQHGHYDVVQRGRGGAGVALGRRGGRXPSDGTE
LGGAASSRALSVPLQSGINAHVRNTYNQTALDIVNQFXPSRWGWDLGGALADASAALQVR
AVKDYCNNYDLTSLNVKAGDVITVLEQHADGRWKGCIHDNRTGNDRVGYFPSSLVEAISK
RTGSVPLSCVGGCPVPVPGHGTAPAPPPPSPPGAAAGSARLQPGRCPRGTGGDRSSLGST
GSSGSGQSAGSGAHALHASSEGVKVRLGMGPVLLAPSVAAAAPAGEDAHAAGMQVPEGCA
HTHTQPQAGRLLTHSVGTQXVLPLSLQSSEAVYQWLCKFQLQLYAPNFINAGYDITTISR
MTPEDLTAIGVTKPGHRKKIASEINNLNIPEWLPANLALWLSMIGLSQYYKLLVENGYEN
IDFITDITWEDLQEIGITKLGHQKKLMLAXQRAELGKYEPGTLKRKAAAGPEVLAIE
Download sequence
Identical sequences U3IFW2
ENSAPLP00000006134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]