SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006193 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006193
Domain Number 1 Region: 178-319
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 70-177
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 1-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-19
Family First domain of FERM 0.0000292
Further Details:      
 
Domain Number 4 Region: 468-532
Classification Level Classification E-value
Superfamily Moesin tail domain 4.18e-18
Family Moesin tail domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006193   Gene: ENSAPLG00000006504   Transcript: ENSAPLT00000006834
Sequence length 568
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743627.1:48311:69941:1 gene:ENSAPLG00000006504 transcript:ENSAPLT00000006834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVPTEEPVTFHFL
AKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPNV
HKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMY
GVNYFAIRNKKGTELLLGVDALGLHIYDPDNRLTPKISFPWNEIRNISYSDKEFTIKPLD
KKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQ
RLAREKQMREEAERTRDELERRLMQLKEEATMANEALMRSEETADLLAEKAQITEEEAKL
LAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEMLALKMAEESERRAKEADQLKQD
LQEARESERRAKQKLLEITSKSSYTQSMNSSTTALPTDLPSFNLISESLSFDFKDTDMKR
LSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENASRALNQGAGG
LSCWWLWFHSCCNQASSSQCSVEGWGGL
Download sequence
Identical sequences U3IG21
ENSAPLP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]