SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006212 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006212
Domain Number 1 Region: 546-620
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.62e-17
Family SAM (sterile alpha motif) domain 0.042
Further Details:      
 
Domain Number 2 Region: 628-699
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000314
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 3 Region: 705-781
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000864
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000006212
Domain Number - Region: 100-155
Classification Level Classification E-value
Superfamily MPN010-like 0.0034
Family MPN010-like 0.0086
Further Details:      
 
Domain Number - Region: 191-258
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0173
Family HBL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006212   Gene: ENSAPLG00000006571   Transcript: ENSAPLT00000006855
Sequence length 904
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742690.1:395917:465279:-1 gene:ENSAPLG00000006571 transcript:ENSAPLT00000006855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLSLLNQTLLFSLGLGTKSAAEYANGAYDIVSPAPSVYLGTFQILHLLEDLKMALEMLED
PQEKEALRNQIPGATAVCIREWFEENLSQVNHHSSTNNETYQERLARLEGDKESLILQVS
VLTDQVEAQGEKIRDLEICLEGHQLKLNATEEMLQQELLSRTSLETQKLDLMAEVSDLKI
KLVGMEKEQSEYEEKQNKAEGLLQELRHLKIKVEELENERNQYEWKLKATKAEIAQLQEQ
LALKDAEIERLQSQLSRTSSHSEVAERDQEVQRLKIGMESLLAANEEKDRRIEELTLLLS
QYRRVKEIMIAAHGSSDRILSGGNEEELEATLRKWNILNNPQGDLFKSEASSGELPPATL
SPVPHKATEIRVPQKKKSSSLEDLQSESLEKYVEGKPVQPVVEQESKPHVKGSKYQTLPG
KLPRPLQNGEQGTYNTSNSPDSCGMNDSEDNSILGLRETENVDGTVVSDDLSPLSSGTDS
GPQSPLSPENRKSPKGIKKIWGKIRRTQSGNFPADDLGLAEFRRGGLRATAGPRLSRSKE
TKGQKSDYNAPFAQWSTERVCNWLEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKEMGI
KHPLHRKKLVLAIKSINAKQDEKSAQLDHIWVTRWLDDIGLPQYKDQFHESRVDGRMLQY
LTVNDLLFLKVTSQLHHLSIKCAIHVLHVNSFNPHCLRRRPVEENNVSPSEVVQWSNHRV
MEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFNGDTLAMLLNIPPQKTLLRRHLTTNFNI
LIGPEAQQEKRDITESTAYTPLTTTAKVRPKKLGFSHFGNLRKKKFDESTDYICPMDTNP
GATNGTQKNYGGYKGLSPFTDRELDQMEHSEGTVKQIGAFSQGISNLTTMLSQDEMLNDS
RFLT
Download sequence
Identical sequences U3IG40
ENSAPLP00000006212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]