SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006278 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006278
Domain Number 1 Region: 184-300
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.04e-38
Family An Obfc1 domain 0.00031
Further Details:      
 
Domain Number 2 Region: 33-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-24
Family Single strand DNA-binding domain, SSB 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006278   Gene: ENSAPLG00000006661   Transcript: ENSAPLT00000006921
Sequence length 361
Comment pep:novel scaffold:BGI_duck_1.0:KB742388.1:1693508:1719216:1 gene:ENSAPLG00000006661 transcript:ENSAPLT00000006921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSESRKYEEETPSLFWGLDPVFSAFARLYIKDIKEMRESKQVPGIFFYNGHPVRQVDVV
GIVVHTKERDAFYSYGVDDSTGVINCVCWKNPMVSRSLSGSPSTLSSLKVLEQMKKLQET
VSQKTKLVIGDVVRVRGYIRTYRQQREIQASCFYKVDDPVCDVQISRLLELPCLYREVYD
KPFQSPGEGQSSPEGLDFSIYILHEKVKDFLLENKIQTFYQQELETIDTLVSLAGEPLSS
RSCQVNSKPDSSSKRIHSVFKEAIKMLQEEGVVFQKPSSSKDLYHVTDYDKDLLKVTLDV
VKEDCRKPRHAEKGCHFLHVLNCVRQNYNPSLAEVVMHRVLELLESNSDVVSTMEGYYMA
F
Download sequence
Identical sequences R0LTL1
XP_005008981.1.99704 XP_005008982.1.99704 XP_005008983.1.99704 XP_005008984.1.99704 XP_005008985.1.99704 XP_012958151.1.99704 XP_012958192.1.99704 XP_012958228.1.99704 XP_012958280.1.99704 ENSAPLP00000006278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]