SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006344 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006344
Domain Number 1 Region: 271-599
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-78
Family p120GAP domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 556-692
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-39
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 124-283
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.56e-25
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 4 Region: 2-110
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.13e-20
Family PLC-like (P variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006344   Gene: ENSAPLG00000006641   Transcript: ENSAPLT00000006988
Sequence length 791
Comment pep:novel scaffold:BGI_duck_1.0:KB742505.1:956518:999622:-1 gene:ENSAPLG00000006641 transcript:ENSAPLT00000006988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAKQLVPNKMRDFFCTINLDQEEVFRTQVVEKSSSPYFGEEFYFEIPRTFQWLSFYIYDK
SVLQKDLRIGKVAIKKEDLCNYTGKENWFMLQPVDSNSEVQGKVHLELKLNELITDNGSV
CQQLVVHIKECHGLPLINGQNCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNETFYFEV
TRSSSYTKKSQFQVEEEDIEKLEVRVDLWNNGNLVQDIFLGEIKVPVKVLRNDSFQAWYL
LQPRENGNKSSKTDDLGSLRLNICYTEDCVLPSEYYVSLRNLLLKSSDVQPISASAAYIL
CEVCRDKYDAVLPLVRLLLHHHKLVPFVAAVAELDLKDTQEANTVFRGNSLATRCVDEMM
KIVGKHYLKVTLKAVIDEICESPKPCEIDPIKLREGDNAEINMENLRYYVDKVFREIVRS
SISCPTLMCDVFYSLRHLAAKRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHP
DAQTSRTLTLISKAIQTLGSWGSLTKSKLSSFKETFMCEFFKTFQEDKFTESVKKFLDDV
SSTESKEPSGLSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSREFTYHKQQDKEPI
FTIPIKNILAVEKLDESSFNKKNMFQVLHGEKPLYIQANNCVEASEWIEALCRVTRCNQK
RLNFYHPSAFLNGSWLCCKATIENTVGCARCTADVPADTQIEIDGDRETERIYSLFTINM
SKLQKLEEACGSIAVYQGPRKEPDDYSNFTIEDSVATFHTLKQIIDIVEKLNESHEKYQK
KRSSSAKYGSE
Download sequence
Identical sequences R0M0T3
ENSAPLP00000006344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]