SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006414 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006414
Domain Number 1 Region: 8-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.84e-66
Family BAR domain 0.0038
Further Details:      
 
Domain Number 2 Region: 387-565
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000021
Further Details:      
 
Domain Number 3 Region: 261-362
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006414   Gene: ENSAPLG00000006763   Transcript: ENSAPLT00000007059
Sequence length 777
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743210.1:597106:654682:-1 gene:ENSAPLG00000006763 transcript:ENSAPLT00000007059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INQSYVKIQRCIADGPRDQLKCYEQELERTNKFIKDVIKDGNALIAAIRSYSSAVQKFSQ
TLQSFQFDFIGDTLTDDEINIAESFKEFAELLQEVELERSMMVQNASDLLIKPLENFRKE
QIGFTKERKKKFEKDGEKFYSMLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLEYV
YQIQEVQESKKFSIVEPVLAFLHSLFTYNNLTVELTQDFLPYKQQLQLSLQNTRNHFSST
REELEDLKKRMKEAPLTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKEAKTLRMTP
MDQKPGAKQSTLDLTLKSCVRRKTDSIDKRFCFDIETNERSGTITLQALSEANRRLWMEA
MDGKEPIYHSPITKQEEMELNEVGFKFVRKCINAVETKGISTEGVYRTVGSNIQVQKLLN
AFFDPKCPGDVDLQSSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVLAAKSENLDYRL
GAIHALVYKLPDKNREMLELLIRHLVNVCEHSRENLMSPSNMGVIFGPTLMRAQEDTVAA
MMNIKFQNIVVEILIEHFGKIYSGPPEDSAAPPVPPPRVAARRHKPITISKRPLRERPVF
FGASVEESGADRYGQTPNGSISSETPKPLLRSRHKAARPPAEVDLGKPVARLQDGGAKLV
AXASPALRTPTLHARRPAPRPGVCGREGEFEGVPKPRSHSDKPVIMRPPVRPPDPPPAPP
CRTPVPQKLEQRPDLIAGTAEEMPSSVVASRTKFFETASRRTSNSSSPQGRIPGDES
Download sequence
Identical sequences U3IGP2
ENSAPLP00000006414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]