SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006438 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006438
Domain Number 1 Region: 128-313
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006438   Gene: ENSAPLG00000006826   Transcript: ENSAPLT00000007083
Sequence length 726
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744185.1:39964:48275:1 gene:ENSAPLG00000006826 transcript:ENSAPLT00000007083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVKELWQDSLLGQTKGPKETRASRDPPIKLLMKVLSSCNTSKTLNAGNMESLIECPSEAD
AKKCPLLGPADTEDGLCHLAADGMKKRKKVISWPFALRRTSASGDSPGQLDSGLKIALFG
QPLAIICGEDDTLPQPVQDLLTILYMKGPSTEGIFRKAANEKARKELKEDLNKGENVDLK
SKTVHLLAVVLKDFLRNIPSKLLSADLYEKWMLALEKPSKEEKIEELREVADKLPRPNLV
LLKHLLSVLHRISQNAASSRMDSNNLAICVGPNMLGPGTDSTLPLEVQKEMNDKVTVLVE
FLIDNCSEIFGEDIAWPARALTEESAEHTDSSTEHLCAAHQNDSAYDSPDPEAECSSCTC
EVGHPKGRSTGVSRRYPTCMSASSLTSCNNDISTMDRRYSEPDLSFQNRFESRIRKQKLN
KSEDNFPVQQKQQGLENAALEKRLAILPSQLSTDSLPKTSSSCSLESSDGSVFTSSPVVS
PSSPKKTFLNRPQSFCTKPNEDCSTPRREIKKHSMSFSFANHRKTLTNPLSWGPGKNTGF
QRDSVTKKDQFSCRIVQENSPEDDKPLPVPYQQRPRFRSADEVFREVDQRNPGRPPSYEE
ATRNCLATHVPSCNLTVQTMRLKVSNQDALLPDPCSSCAQGTACAAPGDLPSERVPAVKD
SDGETETLSVTVGINSRVSLPVTPGVYRLRAMSESCQKNKHEYVARRCSQPIFEVDQIQY
AKESYV
Download sequence
Identical sequences U3IGR6
ENSAPLP00000006438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]