SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006445 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006445
Domain Number 1 Region: 15-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.65e-18
Family DEP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006445   Gene: ENSAPLG00000006814   Transcript: ENSAPLT00000007090
Sequence length 495
Comment pep:novel scaffold:BGI_duck_1.0:KB743317.1:2301868:2308732:1 gene:ENSAPLG00000006814 transcript:ENSAPLT00000007090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGFSLAQKPFGATYVWSSIISALQTQVEVKKRRQNLKCYHDCFIGSDAVDVVFAHLLQNK
YFGDVDISRAKIVRVCQALMDYKVFEAVSTRVFGKDKRSVFEDSSNSLYRFTNISSQTDI
DKDYQQCTPQRDQRTMFQSTPVKAESLEDLWENLSLKPANTPHVNVSENLPRQVINEVWQ
EQTIARLLQLVDLPLLDSLLEHQAVRPQLPQPRKATGYIITSNYLDREILKAFSDSQTDE
WLSAAIDCLEYLPDHMVVDISRNLPDQPDKADAWKLLLFENIGRYYGQKKEPLLSHAPEI
HPGIAELLVNGKMEQSLEALQLYLKLLDSQIREEFRRLLYFMAVAAHNSELKLQEESDNR
MVVKRTFSKAIINNKSLSRGKTDLLILFLVDHQRDVLKIPGTLHKMVSNKLLALQTGQDP
SKITGYTFCEKLDEREYRSMTDKTTKAELLSLLKAIDEDSKLSDKERKRLLGQFHSTNPS
IFMQYFGDRVNNLCV
Download sequence
Identical sequences R0L1P2
ENSAPLP00000006445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]