SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006469 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006469
Domain Number 1 Region: 729-796
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000532
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006469   Gene: ENSAPLG00000006848   Transcript: ENSAPLT00000007115
Sequence length 799
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742981.1:852913:871723:1 gene:ENSAPLG00000006848 transcript:ENSAPLT00000007115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGQFKLLEQDRDIKEPVQYFNSVEEVAKAFPERVYVMEEITFNVKVASGECNEDTEVYN
ITLSTGDELTLMGQAEILYAKSSKEKSRLNTIFKKIGKLNSISKLGRGKMPCLICMNHRT
NESISLPFQCKGKFSTRSPLEVQMQEGEHTIRNIVEKTRLPVNVTVPSPTPRNPYDLHFI
REGHRYKFVNIQTKTVVVCCVLRGNKIIPMHFPLHLTLPKFTLPDSLVKGELWHESLIQH
WFNICQEQFDIDEYSRAVRDVKADWNEDCKSPKKSRCSGHTHVPNSLSYARDELTQSFHR
LSVCVYGNNLHGNSEVNLHGCRDLCNEWALFSHDALQYQDSGDSSSDYLFPEVSEESMFL
PTKPELPYEELWLDQGSGKPGEQPLIRSLSEKSKCDNYRGSFRSKCGTASLPVPGTVGAT
TKSSDVSLPPPPVPPKSEAVKEECRLLNAPPVPPRSSKPSSTSPSIPPRTVKPARQQTRS
PSPTLSYYSSGLHNINVTENDNANPAESSTPVSCYPCTMMKTESKEPENTMPFGSPSTEA
LPSRLSWPNHFSGTAEGLNRSDFLLDPSRSYSYPRQKTPGTPKRNCPAPLTFDFDGCELP
AGYSQLTPAELTNTISSCPKSASYSLDCTDEKTLGVSDTKQSHSCPALPPRAPKPSEEKP
VTDMGPLPLKIDGAEEESKTGSPDLLEDQYLVKKGMQDTFSVSYPFSSPLHLQLAPRSCG
DGSPWQPPTDLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKL
SKLQVKKILQFINGWRPKM
Download sequence
Identical sequences U3IGU7
ENSAPLP00000006469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]