SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006498 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006498
Domain Number 1 Region: 75-157
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000539
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000006498
Domain Number - Region: 17-77
Classification Level Classification E-value
Superfamily EF-hand 0.0171
Family Calmodulin-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006498   Gene: ENSAPLG00000006859   Transcript: ENSAPLT00000007144
Sequence length 673
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743072.1:729313:756044:-1 gene:ENSAPLG00000006859 transcript:ENSAPLT00000007144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPCSSLSPPCFTEEDRFSLEALRMIHKQMDDDKDGGIEVDESDEFLREDMQYKDASNKHS
HLHREDKHITIEDLWRRWKTSEVHNWTQEDTLQWLSEFVELPQYEKNFRDSNVNGTTLPR
IAVNEHAFMISHLKIIDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFVLTVSIVIGFGG
CWFAYTQNRTSKEHITKMMKDLESLQTAEQSLLDLQERLEKAQEENRNVAVEKQNLERKM
MDEINDAKREAHRLRELREGAECELSRLKYAEEELVQVRMALKKAEKEFELRSNWSVPEA
LQKWLQLTHEVEVQYYNIKRQHAEMQLTIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVD
HKILEAKKALSELTTCLRERLYRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRV
SIPPYPIAGGVDDLDEDTPPIVSQFHGSIVKPPSTLARSSSLCRSRRNVVPSSPQSQHAL
HSPDPDILSVSSCPALYRTEEEEEAIYFSADKQWEVQEAGSECDSLNSSVGRKQSPPSSL
EMYQALSPQKVSREELSLEESSTGDSSSLTADISRGSPDCVGMAETKSMIFSPASKVYNG
ILEKSCSMNQLSSGIPVVKPRHTSCSSASSDSKPSHEASSVPRISSIPQDLYQNGEKNKK
PSKIKSLFKKKCK
Download sequence
Identical sequences U3IGX6
ENSAPLP00000006498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]