SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006514 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006514
Domain Number 1 Region: 631-890
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-58
Family Tandem AAA-ATPase domain 0.0000524
Further Details:      
 
Domain Number 2 Region: 399-588,732-775
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.84e-40
Family Tandem AAA-ATPase domain 0.0000535
Further Details:      
 
Domain Number 3 Region: 991-1061
Classification Level Classification E-value
Superfamily HRDC-like 0.00000000000981
Family HRDC domain from helicases 0.03
Further Details:      
 
Domain Number 4 Region: 847-964
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000598
Family RecQ helicase DNA-binding domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006514   Gene: ENSAPLG00000006878   Transcript: ENSAPLT00000007160
Sequence length 1195
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742410.1:141667:157601:1 gene:ENSAPLG00000006878 transcript:ENSAPLT00000007160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYASLSATNDKSGGSQKLSNSEKNSQPEVDEISNELLANIELEEDDYLDVVPPSPEEELP
SFSPSVKSISNIFKESPTGGRSTANGIESKPEKITAKQPVAESDPRAEDADEGPHLEQEL
YSVMDDICKLVDAIPIHELKSLSCAKELLQQRDLRRKLLASSVTLNTSSTNNTFPRNWKA
CVQQDSSAHSGTALCSGPNRSFVRNSPKSTNLSSMLSGTVNSSNFSTENNQTLDDLATSY
VSKQTAQEIVCLETAELSSSKLNSKDRTSLSHPSEMSFNNSWCEKTVVRNGEHWHLPERP
ITSTALKGPSKAPAGTPASECLDVNDPDFDLDNFDIDDFDEGWEENPVTVSAPETPSTPL
YQPLREGPPAKSLLSKIISTAKGSPLVSNPVAPKSSFLTATKNQTEPLVNNPALERFRGM
KFSHSEEMMTIFHRKFGLHTFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSA
GVTIVISPLRSLIIDQVQKLNTLDIAATYLTGDRTDTDASNIYMQLSKKDPIIKLLYVTP
EKVCASNRLMAALENLYNRKLLARFVIDEAHCVSQKWGHDFRKDYKRLNMLRKKFRSVPM
MALTATANPRVQKDIQNQLEMLRPQVFTMSFNRHNLKYDVLPKKPKRVAMDCLEWIKKYH
PHDSGIIYCLSRHECDTTAAILQKEGLSALAYHAGLTDSNRDLVQKKWINQEGCQVICAT
IAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEMSHCLLFYSYSDVTRLRRLIL
MEKDGNSHTRETHFNNLYSMVHYCENVVDCRRIQLLAYFGETNFNPNFCKDHPEVICDNC
SRKKDYKSRNVTEEVKSIIRFVQQHCGQMRGMNAKRNAGSGRYTLNMMVDIFLGTKSAKI
QSGIFGNGAAYSRHNVERLFRKLVLDKILDEDLYITANDQAVAYVILGERAQAVLNGSLQ
VEFHETESASAIRKQRASVTKMSQREEMVKKCLSELTDTCKTLGKVFDVHYFNIFSTSTL
KKIAETLSSDVEVLLQIDGVTEDKLEKYGAEIIKVMDKYSEWTVPEDAACQSVDTAGGST
GTPESEEEAGDVVTTSSYFCNNANQRRKRKRPPNFRESKKKKTSSAGSQQFRPKGGYSKY
RRTKKPSNSKTPPSSGYSSASYSVSATQGTVGKLGIMAPPKPKNRQFLQPSYSLL
Download sequence
Identical sequences U3IGZ2
ENSAPLP00000006514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]