SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006553 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006553
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-62
Family DNA replication factor Cdt1 0.000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006553   Gene: ENSAPLG00000006936   Transcript: ENSAPLT00000007199
Sequence length 380
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742421.1:4961:7259:-1 gene:ENSAPLG00000006936 transcript:ENSAPLT00000007199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRGQKLPAYQRFHALAQDQPPGLTLPYKYKVLAEMFRSVDTIAGMLFNRAETITFAKVKQ
GVQDMMRKQFEERHVGQIKAVYPTSYRLRQEKNIPTFSSGVKKSDYQLTLEPVLGEDEKL
CGRPHLSASRLLERRREFNRSLVNIVKQHHAAFLAGLTPPMVVPEDKLTRWHPRFNVDEV
PDISPAELPRPPQEERVTTAQELLSTARGMMIPKMEKALANLALRSAEAGAGEPMVSKAP
SPASTSSALKGVSQELLERIRAKEARKLQALMTRDAGQEEXMAESFPTQMTAGRKWAHRA
PGWCRGFWGDSGCGELSPAALLFHPVGEMEKHLRLFAELLPDWVGIHAIRTDTYIKLDKN
KDVGLVVERLTKVAKEAEAL
Download sequence
Identical sequences U3IH31
ENSAPLP00000006553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]