SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006616 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006616
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.92e-55
Family Ankyrin repeat 0.0000832
Further Details:      
 
Domain Number 2 Region: 855-1016
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-45
Family Phosphotyrosine-binding domain (PTB) 0.0028
Further Details:      
 
Domain Number 3 Region: 717-779
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000943
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 
Domain Number 4 Region: 644-712
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000982
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006616   Gene: ENSAPLG00000006934   Transcript: ENSAPLT00000007263
Sequence length 1123
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743510.1:330391:404837:-1 gene:ENSAPLG00000006934 transcript:ENSAPLT00000007263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADCKGCYPLHLAAWKGD
ADIVKLLIHQGPSHTKVNEQNALEIKELKKYGPFDPYINAKNNDNETALHCAAQYGHTEV
VKVLLEELTDPTMRNNKFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAAR
NGHKTVVHVLLDAGMDSNYQTEKGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTAL
DIVRELPSQKSQHIAALIEDYTIGRKSAKAAEKTAQAALVPATDPTCRIPQGDVEKAVTE
LIIDFDVNPEEESPYEALYNATSCHSLDSLASGRSSDRESMNKEAEGAGLKAAGVRPRER
PPPPAKPPPDEEEEQHTEKKIGPLARSQASVARGKSRGSGAEEEEHPYELLLTAETKKPV
AVDRKTKDHRRSSGSRSQDSADGQDIQVPEQFSGLLHGSSPICEISEDPFRLVSSAEKGG
TEATSHPPAMQLEDAALPASGSVRTSSPDQNQKAVYATVQHTHANRADPETVVTPHVLQH
PGGAEDEGDRGGAVGRAHPGSKPKAELKLSRSLSKSDSDLLTCSPTEDDAMGSRSESLSN
CSTGKKRLEKSPSFASEWDEIEKIMSSIGEGIDFSQEQQRISGSRMLEQSVGEWLESIGL
QQYESKLLLNGFDDVRFLGCNVMEDQDLRDIGIAPPHPHPKLLQAARSLPKLKPLGCDGN
SQPSVPAWLDSLGLQDYIQSFLSSGYSSIDTVKNLWELEIVNVLKVNLLGHRKRIIASLA
DRPYEEPPAKPPRFSQLRCQDLVSQTSSPLSQNDSCTGRSADLLLPSGDTGKRQHERGSE
VAPYSRVDRYKAQEERRESKLTLRPPSLAAPYAPVQNWQHQPEKLIFESCGYEANYLGSM
LIKDLRGTESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNIS
CAAQDPDDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQR
AKPLGAAAGETIETKSSKPVPKPRAGVRKSAVPLPPDTRCCYCHTCTTHRPSYLPLQSVS
PGAKLEPPEVDQDSQSHASVSWVVDPKQDSKRTLSTKYETTIF
Download sequence
Identical sequences U3IH94
ENSAPLP00000006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]