SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006617 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006617
Domain Number 1 Region: 596-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-82
Family Protein kinases, catalytic subunit 0.00000000075
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-71
Family Ephrin receptor ligand binding domain 0.000000474
Further Details:      
 
Domain Number 3 Region: 302-508
Classification Level Classification E-value
Superfamily Fibronectin type III 5.21e-35
Family Fibronectin type III 0.0000365
Further Details:      
 
Domain Number 4 Region: 890-961
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.89e-19
Family SAM (sterile alpha motif) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 232-303,341-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000167
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006617   Gene: ENSAPLG00000006930   Transcript: ENSAPLT00000007264
Sequence length 967
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742847.1:491526:546534:-1 gene:ENSAPLG00000006930 transcript:ENSAPLT00000007264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLDTTGETSEIGWTTHPSDGWDEVSVLDDKKRPIRTFEVCNVGEPGQNNWLRTRFIERR
GAHRVHVRLRFSVRDCASMRTVASSCKETFTLYYHQSDADIASQELPEWREGPWTKVDTI
AADESFSQVDSTGKVVKMNIKVRSFGPLTKHGFYLAFQDSGACMSLVAVQVFFYKCPAVV
KGFASFPETFAGGERTSLVESPGKCVANAEETNTSVRLHCNGEGEWMVAIGRCTCKAGYQ
PVDDERACQACLLGSFKMSVGDDPCHLCPAHSHAPLPGSSECVCQNHYYRSASDNSDAPC
TGVPSAPRDLSYEIVGSNVLLTWRLPKDLGGRKDVFFNVICKVCPTGSPGPCVRCGDSVQ
FEPRQMGLTESRVQVSNLLARVQYTFEIQAVNLVTELSSEAPHYATINVSTSQSVPSAVP
MMHQVSRTTSSITLSWPQPDQPNGVILDYQLRYFDKAEDEDNSFTLTSETNMATILNLSP
GKIYAFQVRARTAVGYGPYGGKMYFQTLMAGERSEMVQDRLPLIVGSALGGLAFLVIAAI
AILAIIFKRSCSKRRETPYTDRLQQYISTRGLGVKYYIDPSTYEDPNEAIREFAKEIDVS
FIKIEEVIGSGEFGEVCFGRLKHPGKRECTVAIKTLKSGYTDEQRREFLSEASIMGQFEH
PNVIRLEGVVTKSRPVMIVTEFMDNGSLDSFLRQKEGQFSVLQLVGMLRGIASGMRYLSD
MNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDASNPTYTGALGCKIPIRWTAPEAVQ
YRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIDQDYRLPPPPDCPTVLHLLM
LDCWQKERVQRPKFEQIVSALDKMIRKPSALKATGTGSSRPSQPLLSNSPPDFLSLSNAH
EWLDAIKMGRYKENFDQAGLITFDVISRMTLEDIQHIGITLVGHQKKILNSIQLMRVHLN
QLERVEV
Download sequence
Identical sequences U3IH95
ENSAPLP00000006617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]