SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006619 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006619
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-27
Family DEP domain 0.002
Further Details:      
 
Domain Number 2 Region: 91-213
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-26
Family DEP domain 0.0047
Further Details:      
 
Domain Number 3 Region: 272-352
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000333
Family PDZ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006619   Gene: ENSAPLG00000006994   Transcript: ENSAPLT00000007265
Sequence length 356
Comment pep:novel scaffold:BGI_duck_1.0:KB742407.1:162575:171375:1 gene:ENSAPLG00000006994 transcript:ENSAPLT00000007265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRLHDGKLIKDRRYHLRTYPNCFVAKELTDWLIDHKEAPDRETGIRLMQKLMDHYIIHH
VCDEHSDYKDAKLLYRFRKDDGTFPLNKDVKVFVRGQSLYEKLVGAEGSILKVREENSVK
YQRTFLGCEMVDWLLGQELLKHGIIQHVSNRHHFFDGDLLYQFWINFRRRRRLTELLNEN
SSRTLSESPDSPFCLRKLNPDPGNTSFLSVQPNKEIKIVSAVRRSSITSLAGNSNPYFSV
TPTLVFPPVAECNPKSVLKRPVTNEELLSPGAPYVKKTLTIVGDAVGWGFVVRGGRPCHI
QAVDPGGPAAAAGMKVCQFVFSVNGMYVLHLDYQTISSLIMTGPRTLVMEVMEAVE
Download sequence
Identical sequences U3IH97
ENSAPLP00000006619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]