SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006644 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006644
Domain Number 1 Region: 383-565
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.0000993
Further Details:      
 
Domain Number 2 Region: 298-361
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000802
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000006644
Domain Number - Region: 32-102
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006644   Gene: ENSAPLG00000006988   Transcript: ENSAPLT00000007292
Sequence length 657
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743269.1:102569:108566:1 gene:ENSAPLG00000006988 transcript:ENSAPLT00000007292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAATLNLLRMFDQLVRQAEVLSEGNEYQFIQLAKNFDEYRRRLQKTEHELGRYKDLLMK
TEAECSALGVKLKHARNQVDVEIKRRQKAEMDCEKLERQIQLIRELLMCDASGSIQLSEE
QKSALAFLNRPQVSMGGSGNKRLSTIDESGSILSDISFDKTDDSLDWDSSVVKAVRLKRR
EKRRSSRQYIEGPPGPQKKIRSIGSAADQGNESIVAKTTVMVPSDGGPIEAISTIQTVPY
SLRSQRKSGRCHGSICSSPETTMQWAGGCPIMLGPLQPWNSDSNLGNKQLESKSESNGSC
TPQNNGGVRLHEFVSKTVIKPESCVPCGKRIKFGKISLKCRSCRVVAHPECRDRCPLPCI
PTLTGTPVQIGEGTLMDYVPSAPPMIPSIIVHCVNEIEQRGLHEMGLYRISGCDKTVREL
KEKYLRSKNIPLLSKVDDIHAICGLLKDFLRSLKEPLLTFRLNKTFMEAAEISDEDNSIA
AMYQAVSELPQANRETLAFLMLHLQRYRVAQSPDTKMDVTNLAKIFGPTIVAHAVPDPDA
MTLLQDTKRQPKVVERLLLLPVEYWSQLMLVEQENIDPAHIIENTNAFSTPQTPDVKVSM
LGPLTTPEQQLSKTPSSSSLSQKVRSTFSITPKFGSKSKSTSQLGRQANFFASPMLK
Download sequence
Identical sequences U3IHC2
ENSAPLP00000006644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]