SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006684 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006684
Domain Number 1 Region: 181-476
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-86
Family p120GAP domain-like 0.00004
Further Details:      
 
Domain Number 2 Region: 47-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000427
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 7-47
Classification Level Classification E-value
Superfamily PH domain-like 0.0000208
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006684   Gene: ENSAPLG00000007069   Transcript: ENSAPLT00000007332
Sequence length 535
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744462.1:4970:12557:1 gene:ENSAPLG00000007069 transcript:ENSAPLT00000007332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPFAFPQVTTASGTKCFACRSAAERDKWIENLQRAVKTQPDNSRRVDNVLKLWVIEARDL
PPKKRYYCELCLDDMLYARTTSKARTDNVFWGEHFEFINNLPAVRTIRLHLYKDTDKKRK
KDKSNYVGMGMVSIPIASVTGRHFAEQWYPLSQPSGSKSKAGCPALRVKSRFQTMSILPM
ELYKEFAEYANXLQLLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDR
FMDREHLIFRENTLATKAIEEYLKLIGQKYLKDAIGEFIRALYESEENCEVDPMKCSAST
LADHQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGGRRAREDIADRLISA
SLFLRFLCPAVMSPSLFGLMQEYPDEQTARTLTLIAKVIQNLANFTKFGSKEEYMAFMNE
FLELEWTSMQQFLYEISNLDTLTNSTSFEGYIDLGRELSTLHALLWEVMSQLSKEALLKL
GPLPRLLTDISVALRNPHLQRQPXXXXXXXXXXXXGLVLRGPSADLQPYLVRDLN
Download sequence
Identical sequences U3IHG2
ENSAPLP00000006684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]