SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006817 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006817
Domain Number 1 Region: 590-872
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-82
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-63
Family Ephrin receptor ligand binding domain 0.00000304
Further Details:      
 
Domain Number 3 Region: 275-477
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-40
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 878-921
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000497
Family SAM (sterile alpha motif) domain 0.0067
Further Details:      
 
Domain Number 5 Region: 204-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000581
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006817   Gene: ENSAPLG00000007060   Transcript: ENSAPLT00000007467
Sequence length 922
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742565.1:17039:167553:-1 gene:ENSAPLG00000007060 transcript:ENSAPLT00000007467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNQGASRIFIELKFTLRDCNSLPG
GLGTCKETFNMYYFESDDEDGRNIRENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDV
GPLTKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRNLARFPDTITGADSSQLLEVSGVC
VNHSVTDEAPKMHCSAEGEWLVPIGKCLCKAGYEEKNNTCQVCRPGFFKASPHSPSCSKC
PPHSYTLDEASTSCLCEEHYFRRESDPPTMACTRPPSAPRSAISNVNETSVFLEWIPPAD
TGGRKDVSYYIACKKCNSHSGLCEACGGHVRYLPQQTGLKNTSVMMVDLLAHTNYTFEIE
AVNGVSDQNPGARQFVSVNVTTNQAAPSPVSSVKKGKITKNSISLSWQEPDRPNGIILEY
EIKYFEKDQETSYTIIKSKETMITADGLKPGSAYVFQIRARTAAGYGGFSRRFEFETSPV
SVAASSDQSQIPIIVVSVTVGVILLAVVIGFLLSGSCCDHGCGWASSLRAVAYPSLTWRC
GYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVI
GAEGEFGEVCSGRLKLQGKREFPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLE
GVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIASGMKYLSDMGYVHRD
LAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASD
VWSYGIVMWEVMSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKDRN
SRPKFDEIVSMLDKLIRNPSSLKTLVNASSRVSNLLVEHSPVGSGAYRSVGEWLEAIKMG
RYTEIFMENGYSSMDAVAQVTL
Download sequence
Identical sequences U3IHU5
ENSAPLP00000006817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]