SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006835 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006835
Domain Number 1 Region: 7-757
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-261
Family Motor proteins 0.000000000177
Further Details:      
 
Domain Number 2 Region: 1186-1282
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-29
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 1365-1485
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1767-1837,1880-1924
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-20
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 5 Region: 1302-1357
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000215
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1146-1186
Classification Level Classification E-value
Superfamily PH domain-like 0.000000227
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000006835
Domain Number - Region: 796-894,1188-1213
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00586
Family BAR domain 0.047
Further Details:      
 
Domain Number - Region: 1928-2014
Classification Level Classification E-value
Superfamily PH domain-like 0.0178
Family Third domain of FERM 0.03
Further Details:      
 
Domain Number - Region: 1672-1761
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0344
Family Ras-binding domain, RBD 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006835   Gene: ENSAPLG00000007175   Transcript: ENSAPLT00000007486
Sequence length 2035
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742490.1:3056789:3151536:-1 gene:ENSAPLG00000007175 transcript:ENSAPLT00000007486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFTYKQSTITHQKVTPMHQTSAESVEDMAALVDLHEGSIMHNLFQRYQQDKIYTYIGSI
VASVNPYKTIPGLYDCTAMERYSKHHMGEIAPHIFAVANECYRCLWKRHDNQCILISGES
GAGKTESTKLILKFLSAMSQHSLELSCREKTSCVEQAILESSPIMEAFGNAKTVYNNNSS
RFGKFIQLNICQKGNIQGGRIIDCILVWNRVVRQNPGERNYHIFYALLAGVEEREKDAFY
LSVPENYHYLNQSGCIADKTINDKDSFREVITAMEVMQFSKEEVREVLRLLAGILHLGNV
EFITAGGAQVSFKTALGRSAELLGLDSTQLTEALTQRSMILRGEEILTPLSIQQAIDSRD
SMAMALYSQCFAWVIKKINSRIKSKEDFKSIGILDIFGFENFEVNRFEQFNINYANEKLQ
EYFNKHIFSLEQLEYSREGLVWEDIDWTDNGECLDLIEKKLGLLALINEESHFPQATDST
LLEKLNIQHANNPFYVKPRVAAHNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRES
SLDFIYDLFEHVSSRNNQDTLKCGSKHRKPTVSLQFKESLHSLMATLSSSNPFFIRCIKP
NVQKMPDQFDQTVVLNQLRYSGMLETVRIRRAGFPVRRPFQDFYKRYKVLMRNLTLPEDL
NEKCAVLLRLYDNTSTEWQLGKNKVFLRESLEHKLEKQREVEVTKAAMIIRAHILGYTAR
KRYRKVLYYVVVIQKNYRAFCSRKKFLCLKKAAIVLQKQRRGQLARRVYKEKLEEKRRQE
EERRKEEEERCSMLSCITPSPTFRERQRQEAERLAQQAEEERKKQELAAIQKAQKEAELK
KEVERQKESRQVEEILRLEREIEDLQRVKKQQELSLTEASLQRLQQLRDEELRRLEDEAC
RAAQEFLESLNFAEIDECVRNIERSLSVGSGYPAELTEQTGNACSEKPNFNFSQPYPEEE
VDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTIPAASNTML
IPPAHDTVSLHNSSSGESTYCMPENVSCRPPDSVELISPDGDYDYDQDDYEDGAITSGSS
VTFSNSHSSQWSPDYRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRR
DSVYSCVSLPYFHSFLYMKGGLINTWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGS
STLSRRNWKKRWFVLRQSRLMYFENDSEEKLKGSIDVRTAKEIVDNTGKENGIDLIMGDR
TYHLIAESPEDASQWFSVLSQVHASTEQEIREMHDEQANPQNAVGTLDVGLIDSVCAADN
PDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNN
PKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNV
TVYGRKHCYRLYTKLLNEATRWSSAIQNVIDTKAPIDTPTQQLIQDIKENCLNADVVEQI
YKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPI
PIIQGILQTGHDLRPLRDELYCQLIKQTNKVPNPGSVGNLYSWQILTCMSCTFLPSRSIL
KYLKFHLKRVRDQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALISRQEMTSTVYC
HGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGTTDKAIESRTIVADVLA
KFEKLAATAEAGEMHWKFYFKLYCFLDTEHVPKDSVEFAFMFEQAHEAVIRGHYPAPEET
LQVLAALRLQYLQGDYTPHTTIPEMEEVYPLQKLKSRITQSTKTFTAAEKAEKKRASFLE
GTLRRSFRSGSVSKQKVEEDQMLDMWVKEEISASRTSIIDKWKKLQRMNQEQAMAKYMAL
IKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPL
ANTYKIVVDERELLFETSEVVDIAKLMKAYISMIVKKRYSTSRSVSSHGSQGSSR
Download sequence
Identical sequences U3IHW3
ENSAPLP00000006835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]