SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006877 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006877
Domain Number 1 Region: 896-1019
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-25
Family Ankyrin repeat 0.000000638
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-24
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 3 Region: 1024-1086
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006877   Gene: ENSAPLG00000007222   Transcript: ENSAPLT00000007528
Sequence length 1095
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745110.1:146604:190959:-1 gene:ENSAPLG00000007222 transcript:ENSAPLT00000007528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDH
MMYDHLQKWGPRREEVKFFLRHEESPAESNEQSGRQAQNQRNGINIPVEKRTENGVGNPR
VELTLSELQDMAARQQQQIENQQQMLVAKEQRLRYLKQQERRQQQSVSESEKLQKLKERV
ETQETKLKKIRAMRGQVDYSKIMNGNLSTEIEHISAMFQEKQQELQAAVLKVDQLTQQLE
DLRKGKLNGFQSYNGQVTGPAAVELKKLYQELQIRNRLNQEQNSKLQQQKELLNKRNMEV
AMMDKRINELRERLYKKKVEARQKENIPLNRINGTSSPQSSLSASGRVAAVGPYIQVPSA
GTYAVPVDPVKPQSLTIASSSTHGRSKSANDGNWPLLKQSSAPVVKPPQISNTDWKESSM
DTALKQGTISSQPLPTSVLGSTDKLGLDLGKVPPTIPGVSKQLPQNYGTYPSPVPLGTGS
TNSLERRKDGSLPRPGTSITNRQRPVPLPLPSNVHQPSSSQQIQQRISVPPSPTYQPSGP
PLFPGGDGRPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQQ
AVYNTLNKSVKAVYGKPVLQSGSTSPSPLPFLHGSLPAQTPSQPQSQPQTEVSEKDQELE
NAPPPSENSNVENIPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSIT
EPEGPSGPNIQKLLYQRFNTLAGGIESAPFYQPSNPQDFIGILADVDNGNASTNGNIEEP
ISVQPIVPVPDEPPPPSSDANDNELPSPATEELISTETTNQTPETTEDNNNNLAIVPSTE
ESSSPTPEVSSPVEDEVPLQPALPPPVPPTKRTNLKKPNSERTGHGLRVKFNPLALLLDA
SLEGEFDLVQRIIYEVDDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGW
TPLHCAASCNSVHLCKLLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEK
LGVMNKGVVYALWDYEAQNNDELSFHEGDAITILRRKDDNETEWWWARLNDKEGYVPKNL
LGLYPRIKPRQRTLA
Download sequence
Identical sequences U3II05
ENSAPLP00000006877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]