SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006909 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000006909
Domain Number - Region: 291-377
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000314
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number - Region: 183-266
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0204
Family Ras-binding domain, RBD 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006909   Gene: ENSAPLG00000007292   Transcript: ENSAPLT00000007560
Sequence length 402
Comment pep:novel scaffold:BGI_duck_1.0:KB742883.1:67695:70272:-1 gene:ENSAPLG00000007292 transcript:ENSAPLT00000007560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHPGIAHRVHGWQHQQAGHRGFPRHPQGGDRASCVTVCLFSPPAVMKFMGDHPPRGQTEL
DIVCTLLKLCAEHEALRDEVYCQIIKQLTDNTSSKPDSCQKGWRLLYILTAYYRCSEVLR
PFLLAFLQGASGRPELPFHGISKACEQNFRKTLQFGGRSLFPSSMELKAMVAGRSAKRQL
FLLPGGIERHLKIKTCSVAQDVIEELCCEMGLQRPEAFEEYILFVVTDRGRAGQTVRPLS
RREYILDVATETERMATSYTFWCRRVVWGQPLKFDNELYVTVHYNQVWPPDYLKGLFTVL
PPSRLGEQHFQQLAKLAALQHRAKDAHRLPTAREVQDYVPPQLFQLLTAQSWLHAVTQHA
QQAQALSAHQARAQFLGPELQQQRHRLALHPGRQPERPQLSK
Download sequence
Identical sequences U3II37
ENSAPLP00000006909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]