SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006960 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006960
Domain Number 1 Region: 214-546
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-111
Family Motor proteins 0.0000000534
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000532
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006960   Gene: ENSAPLG00000007341   Transcript: ENSAPLT00000007611
Sequence length 1339
Comment pep:novel scaffold:BGI_duck_1.0:KB743173.1:153279:178321:-1 gene:ENSAPLG00000007341 transcript:ENSAPLT00000007611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLYECLCEAELEKYYPHFAAFGLQKIDELAKISMKDYTKLGVHDMNDRKRLFQLIRI
IKIMQEDETVRDLSKQDFQTSGLFIQPQVTRSGPRRQLRFESFFEENDGTVKDSEPESYG
PSEFSANEEKNSLVELLGHTQPHDSEMIRLTRRDVNTPGICTKNELICTTVSDDIAPLLG
DSETPIIQRVTHISGYNYGLPHSCIRSSTSEKETPWTESEKIRVCVRKRPLGLREERRGE
VNIITVKDKETLLLHEKKEAVDLTQYILQHVFYFDEVFGESCTNHDVYMKTAHPLIQHIF
NGGNATCFAYGQTGAGKTYTMIGTHRNPGLYALAAKDIFRHLEASQSRKDLLVLISFYEI
YCGQLYDLLNGRKRLFAREDSKHVVQIVGLREVQVDSVELLLEVILKGGKERSTGATGVN
SDSSRSHAIIQIQIKDTANRTFGSRISFIDLAGSERAADARDSDRQTKMEGAEINQSLLA
LKECIRALDQEHAHTPFRQSKLTQVLKDSFIGNSKTCMIANVSPSHIATEHTLNTLRYAD
RVKELKKGIKCSTPVTNRRRTAGNVSPKRVQNSPSMPPGEKSSPKKVKLGLQHPSSATKT
KTCPAALQPPSVPFTSTPRGVNKGHAYKGSPSSLWFHHTSPVKGFLRIGHPLKKKTDDLS
PYSEKNPTAKDFVIRNTGTAETKESGQRDKYMQDRPPVQCLKVQTVQPVQKQLVSRDDFS
FGDGNLPSDSRQEWGNTFVKPCVETWTNLSPFQKEREEHLRLYHQQFQQPPILQHKLNYQ
PLERFLTQYKPQEIEVKQELSLTPTEAQNKEGMQLEDLDDSDFSEDSFSPVCSQNNVKRR
NTNKCSKHSFFLHQREQGTEEEQKGQKRQDLFFKYAMHSQEHELDNSWDCSEGSPKMEES
IKNAGCSKTPSDWSYDLAMESSASNTAEKPCCLQEDSACNWKNSQDFLADDKQYKSKHRC
SVYSSEVTLTPEKDTSNSYSSPVLKSGTPECKEILHQREEKEESVLDGQAAVAGDIKWKA
RKNDVNCCGSTSCSSEFTPELVAPLPVPLLDFLDYEETADAETVSSNQEKSPRVKQLLGR
SIHRPQKRFEEEAWQCTRSRALTDSMLELGEQVRRGGRHCALQRCPQAGDRWLSPGCCGS
SNPGVVPSSLIGNDLAEASTAECTESRGEREDGRQPDADVKGNTINSGKLNSNQGLNVEP
WERNAEIPEKSFFSGASCLLTVGNTDYAVQSHSQESSLLQSKSGLRNEDLSHSEEPAKSS
FSNIFCCSISLCLTRQAMIRAHRQQLDEMASLCFKEECLINQMSATDFQNFVTKLDEILV
LKSKCIQTMRAQLQLYLAS
Download sequence
Identical sequences U3II88
ENSAPLP00000006960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]