SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007051 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007051
Domain Number 1 Region: 312-389
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-20
Family PCI domain (PINT motif) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007051   Gene: ENSAPLG00000007388   Transcript: ENSAPLT00000007702
Sequence length 420
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742832.1:419502:425341:1 gene:ENSAPLG00000007388 transcript:ENSAPLT00000007702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGRLQEVIENLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKDWDALNENIILLSKRRSQ
LKQAVAKMVQQCCTYVDDITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQN
GEVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQE
ENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVIL
SPYDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWTALVEEYGKELREGSLDSP
ATDVFGCTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEEFLSNL
VVNKTIFAKVDRLAGIINFQRPKDPNNILNDWSHKLNSLMALVNKTTHLIAKEEMIHNLQ
Download sequence
Identical sequences A0A093C3F7 U3IIH9
ENSAPLP00000007051 XP_009977566.1.11325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]