SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007079 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007079
Domain Number 1 Region: 39-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-53
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 421-489
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000244
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007079   Gene: ENSAPLG00000007413   Transcript: ENSAPLT00000007733
Sequence length 658
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743321.1:113382:124629:-1 gene:ENSAPLG00000007413 transcript:ENSAPLT00000007733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELSDEASESELLSRSLSMWHGVGQMICREELDVPLDLHTASSIGQYEVVQECIQRGDL
DLNKRNCGGWTPLMYASYIGHDTIVHLLLEAGVNVNIPTPEGQTPLMLASSCGNESVAYF
LLQQGAELEMKDIHGWTALFHCTSAGHQQMVKFLLDNGANANCKEPVYGYTPLMEAAASG
HEIIVQYLLNHGVKADVRDNTGATARTLAMKYGHTKIVGLIDLHAAPVPKVFCRGPGKYE
ELSSSDESCSAPQRQRPVRRTKGPSIHDGPQALAKITAVGIGGKKQSRYEQVPPQGYVTF
NDDGSCEADGIRNRDVTSPINEQDVESSSSRAREDNVFFTNNLATIRSSSSSSECLTKAL
GVSSEGSLESNEDSDHANSPPSRKQAKSFKVKNRYSNSDNQWTHCPGKAGGSSQHLMLPE
PPAYTGPQDLATFLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITLFGPKRKMTS
AIARWHSNARPPSDALELAYADRLEAEMQELAIQLHKRCEEVEVMKGQVCQEQKLRAVAE
SCLMERDESWNAIQCQLREAQAITKDAGVLLDQIKSCQAELSSRLTQEQAAGRVLDTKVQ
LGTVREGWPPSLKSLSLPELSAVLEKCVGEMGKALQTVTQNLQRLQAPGQGGQSWLEP
Download sequence
Identical sequences U3IIK7
ENSAPLP00000007079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]