SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007123 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007123
Domain Number 1 Region: 12-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-35
Family Forkhead DNA-binding domain 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007123   Gene: ENSAPLG00000007505   Transcript: ENSAPLT00000007778
Sequence length 113
Comment pep:novel scaffold:BGI_duck_1.0:KB743145.1:1206006:1207599:1 gene:ENSAPLG00000007505 transcript:ENSAPLT00000007778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTCSSDEEKKFTRPAYSYIALIAMAIQQSPSNKVTLSGIYDFIMKKFPYYRSNQRAWQNS
IRHNLSLNSCFVKVPRTEGNEKGKGNYWSFATGCESMLDLFENGNYRRRRRRR
Download sequence
Identical sequences A0A087RFU7 A0A087VGP3 A0A091FBA9 A0A091GHG9 A0A091GXT8 A0A091I8K1 A0A091JF53 A0A091KWN5 A0A091L7Y0 A0A091LRC1 A0A091MSB4 A0A091N7I8 A0A091P3R5 A0A091PGH2 A0A091QN50 A0A091SVL5 A0A091T9I4 A0A091U829 A0A091UI32 A0A091V912 A0A091XAJ4 A0A093DX01 A0A093FA30 A0A093FWM4 A0A093GZQ3 A0A093J8H5 A0A093LP72 A0A093NHL5 A0A093QK59 A0A093R442 A0A094KSE0 A0A094L6L5 A0A099YS21 A0A099ZXM3 U3IIQ1
ENSAPLP00000007123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]