SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007179 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007179
Domain Number 1 Region: 539-678
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-36
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 202-303
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-17
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 27-83
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000209
Family SAM (sterile alpha motif) domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007179   Gene: ENSAPLG00000007509   Transcript: ENSAPLT00000007834
Sequence length 1040
Comment pep:novel scaffold:BGI_duck_1.0:KB742549.1:1081133:1194660:-1 gene:ENSAPLG00000007509 transcript:ENSAPLT00000007834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGIYCETFWGQNRITTIFVGLDDCLQQYIKNFEREKINGEQLLHITHQELEELGVTRI
GHQELILEAVDLLCALNYGLETENLRTLSHKLNASAKNLQNFITGRRRSGHYDGRASRRL
PNDFLTSVVDLIGAAKNLLAWLDRSPFVSVTEYSLLKNNIVQLCLELTTIVQQQDCTVYE
TENKILHVCKTLSGICDHIISLSSDSLVSQSAHLEVVHLTSIMPSEGLGMYIKSTYDGLH
VITGTTENSPADQCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPNGVILTLKKRPQN
TLVSAPALLKNVRWKPLALQPVIPTSPTSSSTTPTSTMGMSSKMENSALQDVYILSPMSG
LYGPRDEIGIMSCDDISKFGKSGMKGSESPSYFLEHESGKYYTLIEGEGHALGSEYERSR
ATGVRRREKTPTHGDLRPVSMPTDYSWIGESKEQNMYKRGSRVENSLLRYLSDDKILVIQ
EEPLTQKDSKRDTGHRSRKKGKNASSPNYPISSSMLTSTVNVRLEPGQQDILNFSLPENN
TVPLYHSFHYASLRVKSRKWSKGSSLTGGSRRRISCKDLGHGDCEGWLWKKKDAKGYFTQ
KWKKYWFILKDSSLYWYTNQNDEKAEGFISLPEFRIDRAIECRKKHAFKACHPKIKSFYF
ATDCLEEMNRWMNRLGLAAIGYTPDDKDIHPDEADYWSESDQDDVDGSLTLKQEGSSTLC
DSYHRTPSVTSTSPFPETKHGRHFSSESTYSHSSAEDSRQDVAGSTHSSGCRPPYRERRS
WQDLIETPLTSSGLHFLQTVPPDPEYMSGRPGMSPDRRKQATLPVQRRHNYEQDGPFPLA
ECQRGHSSHSRPQKQRSQSLPRNRDVRGKGRLKSIEGADENLEEKIPIRRHNSFCVEGKL
SEENLKETGENSDGLQELYKSLEQASLSAFGEQRPSTKQEFRKSFVKRCNDPVINEKLHH
IRALKSTLKAKEGDLTVINSLLDDPNLTSKKFKDWKLKNYEFFLDICEYSAALKSQNGAS
ELATSAPMLTHTHSFIETHV
Download sequence
Identical sequences U3IIV7
ENSAPLP00000007179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]