SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007204 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007204
Domain Number 1 Region: 257-347
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-27
Family La domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000007204
Domain Number - Region: 199-233
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.0654
Family Ribosomal proteins L15p and L18e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007204   Gene: ENSAPLG00000007559   Transcript: ENSAPLT00000007862
Sequence length 882
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743924.1:485378:496150:-1 gene:ENSAPLG00000007559 transcript:ENSAPLT00000007862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFAEQTTPAKVVRAANPRQRKGSKVGDFGDATNWPTPGEIAHKSVQQPHKAPSLRKLPVK
KDMKEQEKGDGSDGKESLKTKSDESGEEKNGDDDNQKSAQKKKGNKHKWVPLQIDMKSEV
PRDKTASRNNRQNEQHRHPSNNRGELKGSCLPPVTPLLPLCSPSAAGWHPDNKHERSWQD
HDETSSVKSEGGAVRGAFRGRGRGRGRGRGRGRGGTCSHFDYQYGYRKFEGSDGSRTQKY
ASNITYYFDNISSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDSDGFLPIT
LIASFHRVQALTTDISLIIKALKDSKVVEIVDQKIRRKEQPEKWALPGPPMADYTQTDFS
QFINCPEFVPRQSFQKETESAPGSPRPASPVPTKTEEVSNLKTMPKGLSASLPDLDSETW
IEVKKRPRPSPARPKKPEESKTPQQQKQKDQDEPEELDFLFDEEMEQMDGRKNTFTDWSD
EDSDYEIDDRDVNKILIVTQTPPYLRRHPGGDRTGNHTSRAKMSSELAKVINDGLYYYEQ
DLWTEQFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTD
ALANKLFGVPEPSTIARSLPTTVPESPNYRNARTPRTPRTPQLKDPTQTPRFYPVVKEGR
TIDAKTPRKRKTRHSSNPPMECHVGWVMDSREHRPRTTASISSSPSEGTPAVGSYGCTPQ
SLPKFQHPSHELLKENGFTQHVYHKYRRRCLNETERKRLGIGQSQEMNTLFRFWSFFLRD
HFNKKMYEEFKQLAVEDGKEGYRYGLECLFRYYSYGLEKKFRPDIFKDFQEETIKDYEAG
QLYGLEKFWAFLKYSKAKNLDINSKLQEYLSKFKRLEDFRVD
Download sequence
Identical sequences U3IIY2
ENSAPLP00000007204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]