SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007228 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007228
Domain Number 1 Region: 17-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000565
Family Ubiquitin-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007228   Gene: ENSAPLG00000007564   Transcript: ENSAPLT00000007886
Sequence length 308
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744110.1:28219:40895:1 gene:ENSAPLG00000007564 transcript:ENSAPLT00000007886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVSYQVEILDWKTKEQLCFLDKVEPNATIREIRLMFHKLYPRWYPARQSIKLDPKGKSLR
DEEILQHLPVGTTATLYFKDLGPQIGWTTVFLIEYTGPLFIYFLFYFRMPFVYGLDERFT
SSPHPVVNLACICHSFHYIKRLIETIFVHRFSHGTMPLRNIVKNCLYYWGFAAWLAYYIN
HPLYTPPSYGKKQINFAVIMFLLCEAGNFSIHVALSDLRRDGSKTRKIPYPTKNPFTWLF
FFVSCPNYTYEVGTWISFTVMTQCVPVGLFTLLCFIQMTIWAKDKHYTYLREFKDYPSLR
MPIIPFLL
Download sequence
Identical sequences U3IJ06
ENSAPLP00000007228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]