SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007295 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007295
Domain Number 1 Region: 138-234
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 4.97e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 218-331
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.78e-29
Family UBX domain 0.0000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007295   Gene: ENSAPLG00000007644   Transcript: ENSAPLT00000007954
Sequence length 334
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742582.1:994265:1010377:1 gene:ENSAPLG00000007644 transcript:ENSAPLT00000007954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQLALAELYEDEAKRQALCPDKPTTTKMNSSKVSQGLKIDSFRSLRKPERSMSDDKENQR
FYSGDSEYRGLQISGASNNPSKIVAELFKEAKEHGAVPLDEASRSSGDFNKAKSFSGGGY
RLGDSSQKHSEYIYGENQDHSYEQVQVLLKLWRNGFSLDDGELRSYSDPTNAQFLESVKR
GEIPVELQRLVHGGQVNLDMEDHQEQEYVKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPE
EEEKSILNAPVLIDDSMPATKIQIRLADGSRLIQRFNQAHRIKDIRDFIIQSRPAFATTD
FVLVTTFPNKELTDESLTLQEADILNTVILQQLK
Download sequence
Identical sequences U3IJ73
ENSAPLP00000007295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]