SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007298 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007298
Domain Number 1 Region: 142-335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 53-109
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000235
Family CRAL/TRIO domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007298   Gene: ENSAPLG00000007670   Transcript: ENSAPLT00000007957
Sequence length 346
Comment pep:novel scaffold:BGI_duck_1.0:KB743149.1:1207:45823:1 gene:ENSAPLG00000007670 transcript:ENSAPLT00000007957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFFIDDINLLCCINHFLDTNYHSIYNILYFIFGERQRLTKSFGHLIAAQENVNRYKKNLK
ALYVVHPTNFIKILWNIFKPLTSHKFGKKIIYLKYLSDLREHLKYDQLNIPQEVIQHDEN
LWRKQKGKLPPVVKIPPPRPPLPTQQFGVSLQYIKDKNKGELIPPVMKETVSYLKRKGLQ
VEGLFRRSASVQTIKDVQKLYNQGKSVNFDYYHDIHIPAVILKTFLRELPQPLLTFECYD
HILGITSVESSLRVTRCKQIIHGLPEHNYVVLKYLICFLHMVSRESIYNRMTASSLACVF
GLNLIWPSKGTVSLSALVPLNLFTELLIDFYMNIFNSRTVPGEILP
Download sequence
Identical sequences U3IJ76
ENSAPLP00000007298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]