SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007332 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007332
Domain Number 1 Region: 639-834
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000294
Further Details:      
 
Domain Number 2 Region: 456-577
Classification Level Classification E-value
Superfamily PH domain-like 9.98e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 10-91
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000788
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 253-293
Classification Level Classification E-value
Superfamily WW domain 0.0000000501
Family WW domain 0.0026
Further Details:      
 
Domain Number 5 Region: 358-387
Classification Level Classification E-value
Superfamily WW domain 0.0000359
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007332   Gene: ENSAPLG00000007667   Transcript: ENSAPLT00000007993
Sequence length 836
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744292.1:666019:735914:-1 gene:ENSAPLG00000007667 transcript:ENSAPLT00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKGGKILPGQLYIEVEYDYEYEAKDKKIVIKQGEKYILVKKTNDDWWQVKRDENSKPF
YVPAQYVKEIPRKALMPPVKQAGMLSNNALKLTHGLQRSTENVNKSPELSSFGKSSPVQV
SCLVRDANQNLGPNNSPGQTLGLSLDLTQNNGKLNNELQSPKISNQYRTISMGHFPCPEF
LEIEKTSFLHEQSCDSAGEGSEKIHQDSESGDELSSSSTEQVQPTTPPSQGRPDSPVYAN
LQELKISQSALPPLPTSAPVQINGEWETHKDTTGRCYYYNRGSQERTWKPPRWARDASIN
KGDSQSHADHEHLSSEENDHSSCYSQSDSQYGSPPRGWSEELDEHGQTLYTNDYTNEKWL
KHADEQGRPYYYSADGSRSEWELPKYNASPQQQRDIIKSRSLDRRLQEPIVLTKWRHSTI
VLDTNDKESSTASKASFPENESSPSSPKHQATGQEKYGLLNVTKITENGKKVRKNWMSSW
AVLQGSSLLFTKTQGSGTGWFGVNQSKPEFTVDLKGALIDWASKDKSSKKNVIELRTRQG
TELLIQSDNDSFINEWYKVLNYTINNQVESDEALEDEVPDSPGVEKQDKEKENKDSKKLR
SMKMSSNIDSTDQKKTKTKLKKFLTRRPTLQAVREKGYIKDQVFGSNLTSLCQRENSTVP
KFVKLCIEHVEEHGLDVDGLYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITGAL
KMFFRELPEPLFTYNHFNDFVNAIKQEPRQRVHAVKDLIKQLPKPNQDTMQVLFRHLKRV
VENGEKNRMTYQSVAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLELNAIFGR
Download sequence
Identical sequences U3IJB0
ENSAPLP00000007332 XP_005027922.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]