SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007354 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000007354
Domain Number - Region: 29-98
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000102
Family RIO1-like kinases 0.0052
Further Details:      
 
Domain Number - Region: 2-23
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0049
Family HxlR-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007354   Gene: ENSAPLG00000007733   Transcript: ENSAPLT00000008016
Sequence length 98
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743633.1:530065:531277:-1 gene:ENSAPLG00000007733 transcript:ENSAPLT00000008016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVQGYRLTNAGYDYLALRTLSSRQVISSVGNQMGVGKESDIYIVANEDEQQFAMKLHRLG
RTSFRSLKNKRDYHKHRHKMSWLYLSRLAAMKEFAYMK
Download sequence
Identical sequences U3IJD2
ENSAPLP00000007354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]