SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007359 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007359
Domain Number 1 Region: 117-212
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.26e-37
Family Forkhead DNA-binding domain 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007359   Gene: ENSAPLG00000007723   Transcript: ENSAPLT00000008021
Sequence length 520
Comment pep:novel scaffold:BGI_duck_1.0:KB742959.1:31985:45835:-1 gene:ENSAPLG00000007723 transcript:ENSAPLT00000008021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTFRFPSTNIKITFTALSNEKREKQEAPESPVKPVQPQISPLTINIPDNMAHLISPLPSP
TGTISAANSCPSSPRGAGSSGYKMSRVIPSDLHLMADNSQSENDKEASGGDSPKDDSKPP
YSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVP
RSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHSGVL
SAHSSGVQTPESLSREGSPVPMEPEPSAIQPKLAVIQEARFAQSAPGSPLSSQPVLITVQ
RQLPQTIKPVTYTVATPVTTSTSQQPVVQTVHVVHQIPAVSVTNVTGLAPANTYTVAGQA
VVTQAAMVTQPKVEPQENGDHKEVKVKVEPIPAISHATIGAASRIIQTSQTTPLQTVTIV
QQAPLGQHQLPIKTVTQNGTHIVPITTAIQGQGNAAAASPLHMLATHASASASLPTKRQN
GDQSEQQELKRIKTEDGESIVIAVNVDTPSVAVSDKGSQN
Download sequence
Identical sequences R0LLC8
ENSAPLP00000007359 XP_009871433.1.31609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]