SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007364 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007364
Domain Number 1 Region: 265-460
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000525
Further Details:      
 
Domain Number 2 Region: 14-150
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-25
Family SH2 domain 0.000000391
Further Details:      
 
Domain Number 3 Region: 198-259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007364   Gene: ENSAPLG00000007680   Transcript: ENSAPLT00000008026
Sequence length 460
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743108.1:17235:93433:1 gene:ENSAPLG00000007680 transcript:ENSAPLT00000008026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDIVFSDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREEAD
QLLSVAEGSYLIRESQRQPGTYTLALSRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTD
GLITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAHKKHMPTLRDAHDGKESTGEDEV
AEKRLTSLVRRATLKENEHVPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADC
GLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHFTKRPMVVDMCIREIESRGLNS
EGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDA
YPKFIESAKTTDPDEQLEILHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMSAENLG
IVFGPTLMRAPELDAMAALNDIRYQRLVVEMLIKNEDILF
Download sequence
Identical sequences U3IJE2
ENSAPLP00000007364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]